Myosin light chain 3 (MYL3) (NM_000258) Human Mass Spec Standard

CAT#: PH303122

MYL3 MS Standard C13 and N15-labeled recombinant protein (NP_000249)

Product Images

Coomassie blue staining of purified MYL3 protein (Cat# TP303122). The protein was produced from HEK293T cells transfected with MYL3 cDNA clone (Cat# RC203122) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203122
• Predicted MW: 21.9 kDa
• Protein Sequence:
  Sequence Link

  >RC203122 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMK
  ITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVF
  DKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSNGCINYEAFVKHIMSS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000249
• RefSeq Size: 942
• RefSeq ORF: 585
• Synonyms: CMH8; MLC-lV/sb; MLC1SB; MLC1V; VLC1; VLCl
• Locus ID: 4634
• UniProt ID: P08590, A0A024R2Q5
• Cytogenetics: 3p21.31
• Summary: 'MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)