PSG5 (NM_002781) Human Mass Spec Standard

CAT#: PH303134

PSG5 MS Standard C13 and N15-labeled recombinant protein (NP_002772)

Product Images

Coomassie blue staining of purified PSG5 protein (Cat# TP303134). The protein was produced from HEK293T cells transfected with PSG5 cDNA clone (Cat# RC203134) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203134
• Predicted MW: 37.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203134 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPLSAPPCTQHITWKGVLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKG
  QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTF
  NLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKQPIENRILILPSVTRN
  ETGPYECEIRDRDGGMHSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQ
  QSGQKLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002772
• RefSeq Size: 1669
• RefSeq ORF: 1005
• Synonyms: FL-NCA-3; PSG
• Locus ID: 5673
• UniProt ID: Q15238, A0A024R0S1
• Cytogenetics: 19q13.31
• Summary: 'The human pregnancy-specific glycoproteins (PSGs) are a group of molecules that are mainly produced by the placental syncytiotrophoblasts during pregnancy. PSGs comprise a subgroup of the carcinoembryonic antigen (CEA) family, which belongs to the immunoglobulin superfamily. For additional general information about the PSG gene family, see PSG1 (MIM 176390).[supplied by OMIM, Oct 2009]'
• Protein Families: Secreted Protein