GCDFP 15 (PIP) (NM_002652) Human Mass Spec Standard

CAT#: PH303135

PIP MS Standard C13 and N15-labeled recombinant protein (NP_002643)

Product Images

Coomassie blue staining of purified PIP protein (Cat# TP303135). The protein was produced from HEK293T cells transfected with PIP cDNA clone (Cat# RC203135) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203135
• Predicted MW: 16.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203135 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT
  YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI
  EILKVE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002643
• RefSeq Size: 591
• RefSeq ORF: 438
• Synonyms: GCDFP-15; GCDFP15; GPIP4
• Locus ID: 5304
• UniProt ID: P12273
• Cytogenetics: 7q34
• Summary: ''
• Protein Families: Secreted Protein