GCDFP 15 (PIP) (NM_002652) Human Recombinant Protein

CAT#: TP303135

Recombinant protein of human prolactin-induced protein (PIP)

Product Images

Coomassie blue staining of purified PIP protein (Cat# TP303135). The protein was produced from HEK293T cells transfected with PIP cDNA clone (Cat# RC203135) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203135 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLLQLLFRASPATLLLVLCLQLGANKAQDNTRKIIIKNFDIPKSVRPNDEVTAVLAVQTELKECMVVKT
  YLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTI
  EILKVE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Cell treatment (PMID: 27837018)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002643
• Locus ID: 5304
• UniProt ID: P12273
• Cytogenetics: 7q34
• Refseq Size: 591
• Refseq ORF: 438
• Synonyms: GCDFP-15; GCDFP15; GPIP4
• Protein Families: Secreted Protein