SERPINB2 (NM_002575) Human Mass Spec Standard
CAT#: PH303139
SERPINB2 MS Standard C13 and N15-labeled recombinant protein (NP_002566)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203139 |
Predicted MW | 46.6 kDa |
Protein Sequence |
>RC203139 protein sequence
Red=Cloning site Green=Tags(s) MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE YIRLCQKYYSSEPQAVDFLECAEEARKKIYSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002566 |
RefSeq Size | 1922 |
RefSeq ORF | 1245 |
Synonyms | HsT1201; PAI; PAI-2; PAI2; PLANH2 |
Locus ID | 5055 |
UniProt ID | P05120 |
Cytogenetics | 18q21.33-q22.1 |
Summary | '' |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400915 | SERPINB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428363 | SERPINB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400915 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2 |
USD 396.00 |
|
LY428363 | Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 1 |
USD 396.00 |
|
PH327583 | SERPINB2 MS Standard C13 and N15-labeled recombinant protein (NP_001137290) |
USD 2,055.00 |
|
TP303139 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2 |
USD 823.00 |
|
TP327583 | Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 1 |
USD 748.00 |
|
TP723351 | Purified recombinant protein of Human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2. |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review