SERPINB2 (NM_002575) Human Recombinant Protein

CAT#: TP303139

Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2

Product Images

Coomassie blue staining of purified SERPINB2 protein (Cat# TP303139). The protein was produced from HEK293T cells transfected with SERPINB2 cDNA clone (Cat# RC203139) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203139 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQFNEVGANAVTP
  MTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGNYLLESVNKLFGEKSASFREE
  YIRLCQKYYSSEPQAVDFLECAEEARKKIYSWVKTQTKGKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKT
  PFEKKLNGLYPFRVNSAQRTPVQMMYLREKLNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLE
  LLESEITYDKLNKWTSKDKMAEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLF
  LSEVFHQAMVDVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 46.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: In vivo treatment (intracerebral) (PMID: 30093305)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002566
• Locus ID: 5055
• UniProt ID: P05120
• Cytogenetics: 18q21.33-q22.1
• Refseq Size: 1922
• Refseq ORF: 1245
• Synonyms: HsT1201; PAI; PAI-2; PAI2; PLANH2
• Summary: Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Secreted Protein