IP10 (CXCL10) (NM_001565) Human Mass Spec Standard
CAT#: PH303141
CXCL10 MS Standard C13 and N15-labeled recombinant protein (NP_001556)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203141 |
Predicted MW | 10.9 kDa |
Protein Sequence |
>RC203141 protein sequence
Red=Cloning site Green=Tags(s) MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKG EKRCLNPESKAIKNLLKAVSKERSKRSP myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001556 |
RefSeq Size | 1227 |
RefSeq ORF | 294 |
Synonyms | C7; crg-2; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10 |
Locus ID | 3627 |
UniProt ID | P02778 |
Cytogenetics | 4q21.1 |
Summary | 'This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection. [provided by RefSeq, Sep 2020]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419857 | CXCL10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419857 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 10 (CXCL10) |
USD 325.00 |
|
TP303141 | Recombinant protein of human chemokine (C-X-C motif) ligand 10 (CXCL10) |
USD 823.00 |
|
TP723252 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 10 (CXCL10). |
USD 240.00 |
|
TP723726 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 10 (CXCL10 / IP10) |
USD 170.00 |
{0} Product Review(s)
Be the first one to submit a review