Germany
Japan
United Kingdom
China
IP10 (CXCL10) (NM_001565) Human Mass Spec Standard
CAT#: PH303141
CXCL10 MS Standard C13 and N15-labeled recombinant protein (NP_001556)
Product Images
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203141 |
| Predicted MW | 10.9 kDa |
| Protein Sequence |
>RC203141 protein sequence
Red=Cloning site Green=Tags(s) MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKG EKRCLNPESKAIKNLLKAVSKERSKRSP myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001556 |
| RefSeq Size | 1227 |
| RefSeq ORF | 294 |
| Synonyms | C7; crg-2; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10 |
| Locus ID | 3627 |
| UniProt ID | P02778 |
| Cytogenetics | 4q21.1 |
| Summary | 'This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection. [provided by RefSeq, Sep 2020]' |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419857 | CXCL10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY419857 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 10 (CXCL10) |
USD 436.00 |
|
| TP303141 | Recombinant protein of human chemokine (C-X-C motif) ligand 10 (CXCL10) |
USD 823.00 |
|
| TP723252 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 10 (CXCL10). |
USD 240.00 |
|
| TP723726 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 10 (CXCL10 / IP10) |
USD 170.00 |
{0} Product Review(s)
Be the first one to submit a review