IP10 (CXCL10) (NM_001565) Human Recombinant Protein
CAT#: TP723252
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 10 (CXCL10).
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
|
Tag | Tag Free |
Predicted MW | 8.6 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Bioactivity | Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml. |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001556 |
Locus ID | 3627 |
UniProt ID | P02778 |
Cytogenetics | 4q21.1 |
Refseq Size | 1227 |
Refseq ORF | 294 |
Synonyms | C7; crg-2; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10 |
Summary | 'This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection. [provided by RefSeq, Sep 2020]' |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419857 | CXCL10 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY419857 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 10 (CXCL10) |
USD 325.00 |
|
PH303141 | CXCL10 MS Standard C13 and N15-labeled recombinant protein (NP_001556) |
USD 2,055.00 |
|
TP303141 | Recombinant protein of human chemokine (C-X-C motif) ligand 10 (CXCL10) |
USD 823.00 |
|
TP723726 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 10 (CXCL10 / IP10) |
USD 170.00 |
{0} Product Review(s)
Be the first one to submit a review