AKR1B10 (NM_020299) Human Mass Spec Standard

CAT#: PH303177

AKR1B10 MS Standard C13 and N15-labeled recombinant protein (NP_064695)

Product Images

Coomassie blue staining of purified AKR1B10 protein (Cat# TP303177). The protein was produced from HEK293T cells transfected with AKR1B10 cDNA clone (Cat# RC203177) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203177
• Predicted MW: 36 kDa
• Protein Sequence:
  Sequence Link

  >RC203177 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKR
  EDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLD
  AWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAY
  SPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFK
  LSDEEMATILSFNRNWRACNVLQSSHLEDYPFDAEY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_064695
• RefSeq Size: 1610
• RefSeq ORF: 948
• Synonyms: AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI
• Locus ID: 57016
• UniProt ID: O60218
• Cytogenetics: 7q33
• Summary: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Butanoate metabolism, Fructose and mannose metabolism, Linoleic acid metabolism, Metabolic pathways