AKR1B10 (NM_020299) Human Recombinant Protein

CAT#: TP303177

Recombinant protein of human aldo-keto reductase family 1, member B10 (aldose reductase) (AKR1B10)

Product Images

Coomassie blue staining of purified AKR1B10 protein (Cat# TP303177). The protein was produced from HEK293T cells transfected with AKR1B10 cDNA clone (Cat# RC203177) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203177 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKR
  EDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLD
  AWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAY
  SPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFK
  LSDEEMATILSFNRNWRACNVLQSSHLEDYPFDAEY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_064695
• Locus ID: 57016
• UniProt ID: O60218
• Cytogenetics: 7q33
• Refseq Size: 1610
• Refseq ORF: 948
• Synonyms: AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI
• Summary: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Butanoate metabolism, Fructose and mannose metabolism, Linoleic acid metabolism, Metabolic pathways