RBM17 (NM_032905) Human Mass Spec Standard
CAT#: PH303232
RBM17 MS Standard C13 and N15-labeled recombinant protein (NP_116294)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203232 |
Predicted MW | 45 kDa |
Protein Sequence |
>RC203232 protein sequence
Red=Cloning site Green=Tags(s) MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRGGSSDDRQIVD TPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKD RHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIP PPVYEEQDRPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVG DATEKDASKKSDSNPLTEILKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDD EAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_116294 |
RefSeq Size | 3342 |
RefSeq ORF | 1203 |
Synonyms | SPF45 |
Locus ID | 84991 |
UniProt ID | Q96I25, Q5W009 |
Cytogenetics | 10p15.1 |
Summary | This gene encodes an RNA binding protein. The encoded protein is part of the spliceosome complex and functions in the second catalytic step of mRNA splicing. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 9 and 15. [provided by RefSeq, Mar 2009] |
Protein Pathways | Spliceosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409865 | RBM17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428938 | RBM17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY409865 | Transient overexpression lysate of RNA binding motif protein 17 (RBM17), transcript variant 1 |
USD 325.00 |
|
LY428938 | Transient overexpression lysate of RNA binding motif protein 17 (RBM17), transcript variant 2 |
USD 325.00 |
|
TP303232 | Recombinant protein of human RNA binding motif protein 17 (RBM17), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review