RBM17 (NM_032905) Human Recombinant Protein
CAT#: TP303232
Recombinant protein of human RNA binding motif protein 17 (RBM17), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203232 protein sequence
Red=Cloning site Green=Tags(s) MSLYDDLGVETSDSKTEGWSKNFKLLQSQLQVKKAALTQAKSQRTKQSTVLAPVIDLKRGGSSDDRQIVD TPPHVAAGLKDPVPSGFSAGEVLIPLADEYDPMFPNDYEKVVKRQREERQRQRELERQKEIEEREKRRKD RHEASGFARRPDPDSDEDEDYERERRKRSMGGAAIAPPTSLVEKDKELPRDFPYEEDSRPRSQSSKAAIP PPVYEEQDRPRSPTGPSNSFLANMGGTVAHKIMQKYGFREGQGLGKHEQGLSTALSVEKTSKRGGKIIVG DATEKDASKKSDSNPLTEILKCPTKVVLLRNMVGAGEVDEDLEVETKEECEKYGKVGKCVIFEIPGAPDD EAVRIFLEFERVESAIKAVVDLNGRYFGGRVVKACFYNLDKFRVLDLAEQV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_116294 |
Locus ID | 84991 |
UniProt ID | Q96I25, Q5W009 |
Cytogenetics | 10p15.1 |
Refseq Size | 3342 |
Refseq ORF | 1203 |
Synonyms | SPF45 |
Summary | This gene encodes an RNA binding protein. The encoded protein is part of the spliceosome complex and functions in the second catalytic step of mRNA splicing. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 9 and 15. [provided by RefSeq, Mar 2009] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409865 | RBM17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC428938 | RBM17 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY409865 | Transient overexpression lysate of RNA binding motif protein 17 (RBM17), transcript variant 1 |
USD 325.00 |
|
LY428938 | Transient overexpression lysate of RNA binding motif protein 17 (RBM17), transcript variant 2 |
USD 325.00 |
|
PH303232 | RBM17 MS Standard C13 and N15-labeled recombinant protein (NP_116294) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review