Thioredoxin domain containing 9 (TXNDC9) (NM_005783) Human Mass Spec Standard
CAT#: PH303291
TXNDC9 MS Standard C13 and N15-labeled recombinant protein (NP_005774)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203291 |
Predicted MW | 26.5 kDa |
Protein Sequence |
>RC203291 protein sequence
Red=Cloning site Green=Tags(s) MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGH GEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHI KVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLE KKTIRGKKYDSDSDDD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005774 |
RefSeq Size | 1556 |
RefSeq ORF | 678 |
Synonyms | APACD; PHLP3 |
Locus ID | 10190 |
UniProt ID | O14530 |
Cytogenetics | 2q11.2 |
Summary | The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417071 | TXNDC9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417071 | Transient overexpression lysate of thioredoxin domain containing 9 (TXNDC9) |
USD 396.00 |
|
TP303291 | Recombinant protein of human thioredoxin domain containing 9 (TXNDC9) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review