Thioredoxin domain containing 9 (TXNDC9) (NM_005783) Human Mass Spec Standard

CAT#: PH303291

TXNDC9 MS Standard C13 and N15-labeled recombinant protein (NP_005774)

Product Images

Coomassie blue staining of purified TXNDC9 protein (Cat# TP303291). The protein was produced from HEK293T cells transfected with TXNDC9 cDNA clone (Cat# RC203291) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203291
• Predicted MW: 26.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203291 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGH
  GEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHI
  KVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLE
  KKTIRGKKYDSDSDDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005774
• RefSeq Size: 1556
• RefSeq ORF: 678
• Synonyms: APACD; PHLP3
• Locus ID: 10190
• UniProt ID: O14530
• Cytogenetics: 2q11.2
• Summary: The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome