Thioredoxin domain containing 9 (TXNDC9) (NM_005783) Human Recombinant Protein
CAT#: TP303291
Recombinant protein of human thioredoxin domain containing 9 (TXNDC9)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203291 protein sequence
Red=Cloning site Green=Tags(s) MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGH GEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHI KVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLE KKTIRGKKYDSDSDDD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005774 |
Locus ID | 10190 |
UniProt ID | O14530 |
Cytogenetics | 2q11.2 |
Refseq Size | 1556 |
Refseq ORF | 678 |
Synonyms | APACD; PHLP3 |
Summary | The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417071 | TXNDC9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417071 | Transient overexpression lysate of thioredoxin domain containing 9 (TXNDC9) |
USD 396.00 |
|
PH303291 | TXNDC9 MS Standard C13 and N15-labeled recombinant protein (NP_005774) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review