Thioredoxin domain containing 9 (TXNDC9) (NM_005783) Human Recombinant Protein

CAT#: TP303291

Recombinant protein of human thioredoxin domain containing 9 (TXNDC9)

Product Images

Coomassie blue staining of purified TXNDC9 protein (Cat# TP303291). The protein was produced from HEK293T cells transfected with TXNDC9 cDNA clone (Cat# RC203291) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203291 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGH
  GEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHI
  KVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLE
  KKTIRGKKYDSDSDDD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005774
• Locus ID: 10190
• UniProt ID: O14530
• Cytogenetics: 2q11.2
• Refseq Size: 1556
• Refseq ORF: 678
• Synonyms: APACD; PHLP3
• Summary: The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome