APIP (NM_015957) Human Mass Spec Standard

CAT#: PH303297

APIP MS Standard C13 and N15-labeled recombinant protein (NP_057041)

Product Images

Coomassie blue staining of purified APIP protein (Cat# TP303297). The protein was produced from HEK293T cells transfected with APIP cDNA clone (Cat# RC203297) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203297
• Predicted MW: 27.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203297 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGCDAREGDCCSRRCGAQDKERPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQP
  EDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEM
  IKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAVNEYPDSCAVLVRRHGVYVWGETWEKAKTM
  CECYDYLFDIAVSMKKVGLDPSQLPVGENGIV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057041
• RefSeq Size: 1285
• RefSeq ORF: 726
• Synonyms: APIP2; CGI-29; CGI29; hAPIP; MMRP19
• Locus ID: 51074
• UniProt ID: Q96GX9
• Cytogenetics: 11p13
• Summary: APIP is an APAF1 (MIM 602233)-interacting protein that acts as a negative regulator of ischemic/hypoxic injury (Cho et al., 2004 [PubMed 15262985]). [supplied by OMIM, Dec 2008]
• Protein Pathways: Cysteine and methionine metabolism, Metabolic pathways