APIP (NM_015957) Human Recombinant Protein
CAT#: TP303297
Recombinant protein of human APAF1 interacting protein (APIP)
Frequently bought together (2)
Other products for "APIP"
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203297 protein sequence
Red=Cloning site Green=Tags(s) MSGCDAREGDCCSRRCGAQDKERPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAPSGVQKERIQP EDMFVCDINEKDISGPSPSKKLKKSQCTPLFMNAYTMRGAGAVIHTHSKAAVMATLLFPGREFKITHQEM IKGIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAVNEYPDSCAVLVRRHGVYVWGETWEKAKTM CECYDYLFDIAVSMKKVGLDPSQLPVGENGIV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057041 |
Locus ID | 51074 |
UniProt ID | Q96GX9 |
Cytogenetics | 11p13 |
Refseq Size | 1285 |
Refseq ORF | 726 |
Synonyms | APIP2; CGI-29; CGI29; hAPIP; MMRP19 |
Summary | APIP is an APAF1 (MIM 602233)-interacting protein that acts as a negative regulator of ischemic/hypoxic injury (Cho et al., 2004 [PubMed 15262985]).[supplied by OMIM, Dec 2008] |
Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.