SIAH Interacting Protein (CACYBP) (NM_014412) Human Mass Spec Standard
CAT#: PH303302
CACYBP MS Standard C13 and N15-labeled recombinant protein (NP_055227)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203302 |
Predicted MW | 26.2 kDa |
Protein Sequence |
>RC203302 protein sequence
Red=Cloning site Green=Tags(s) MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKPAAVVAPITTG YTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNLNGKSYSMIVNNLLKPISVEG SSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPSYDTETDPSEGLMNVLKKIYEDGDDDMKRTI NKAWVESREKQAKGDTEF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055227 |
RefSeq Size | 3060 |
RefSeq ORF | 684 |
Synonyms | GIG5; PNAS-107; S100A6BP; SIP |
Locus ID | 27101 |
UniProt ID | Q9HB71, A0A024R904 |
Cytogenetics | 1q25.1 |
Summary | The protein encoded by this gene is a calcyclin binding protein. It may be involved in calcium-dependent ubiquitination and subsequent proteosomal degradation of target proteins. It probably serves as a molecular bridge in ubiquitin E3 complexes and participates in the ubiquitin-mediated degradation of beta-catenin. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Wnt signaling pathway |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415305 | CACYBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423448 | CACYBP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415305 | Transient overexpression lysate of calcyclin binding protein (CACYBP), transcript variant 1 |
USD 396.00 |
|
LY423448 | Transient overexpression lysate of calcyclin binding protein (CACYBP), transcript variant 2 |
USD 396.00 |
|
PH309815 | CACYBP MS Standard C13 and N15-labeled recombinant protein (NP_001007215) |
USD 2,055.00 |
|
TP303302 | Recombinant protein of human calcyclin binding protein (CACYBP), transcript variant 1 |
USD 823.00 |
|
TP309815 | Recombinant protein of human calcyclin binding protein (CACYBP), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review