C10orf7 (CDC123) (NM_006023) Human Mass Spec Standard

CAT#: PH303311

CDC123 MS Standard C13 and N15-labeled recombinant protein (NP_006014)

Product Images

Coomassie blue staining of purified CDC123 protein (Cat# TP303311). The protein was produced from HEK293T cells transfected with CDC123 cDNA clone (Cat# RC203311) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203311
• Predicted MW: 39.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203311 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDSDDEAEEIQWS
  DDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFKSSDFI
  TRDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIR
  RCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQ
  EQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006014
• RefSeq Size: 1566
• RefSeq ORF: 1008
• Synonyms: C10orf7; D123
• Locus ID: 8872
• UniProt ID: O75794
• Cytogenetics: 10p14-p13
• Summary: Required for S phase entry of the cell cycle. [UniProtKB/Swiss-Prot Function]