C10orf7 (CDC123) (NM_006023) Human Recombinant Protein

CAT#: TP303311

Recombinant protein of human cell division cycle 123 homolog (S. cerevisiae) (CDC123)

Product Images

Coomassie blue staining of purified CDC123 protein (Cat# TP303311). The protein was produced from HEK293T cells transfected with CDC123 cDNA clone (Cat# RC203311) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203311 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKKEHVLHCQFSAWYPFFRGVTIKSVILPLPQNVKDYLLDDGTLVVSGRDDPPTHSQPDSDDEAEEIQWS
  DDENTATLTAPEFPEFATKVQEAINSLGGSVFPKLNWSAPRDAYWIAMNSSLKCKTLSDIFLLFKSSDFI
  TRDFTQPFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIR
  RCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQ
  EQDSPAFRCTNSEVTVQPSPYLSYRLPKDFVDLSTGEDAHKLIDFLKLKRNQQEDD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006014
• Locus ID: 8872
• UniProt ID: O75794
• Cytogenetics: 10p14-p13
• Refseq Size: 1566
• Refseq ORF: 1008
• Synonyms: C10orf7; D123
• Summary: Required for S phase entry of the cell cycle.[UniProtKB/Swiss-Prot Function]