HINT1 (NM_005340) Human Mass Spec Standard

CAT#: PH303319

HINT1 MS Standard C13 and N15-labeled recombinant protein (NP_005331)

Product Images

Coomassie blue staining of purified HINT1 protein (Cat# TP303319). The protein was produced from HEK293T cells transfected with HINT1 cDNA clone (Cat# RC203319) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203319
• Predicted MW: 13.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203319 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDD
  ESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005331
• RefSeq Size: 689
• RefSeq ORF: 378
• Synonyms: HINT; NMAN; PKCI-1; PRKCNH1
• Locus ID: 3094
• UniProt ID: P49773, A0A384NPU2
• Cytogenetics: 5q23.3
• Summary: 'This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed. [provided by RefSeq, Dec 2015]'