HINT1 (NM_005340) Human Recombinant Protein

CAT#: TP303319

Recombinant protein of human histidine triad nucleotide binding protein 1 (HINT1), transcript variant 1

Product Images

Coomassie blue staining of purified HINT1 protein (Cat# TP303319). The protein was produced from HEK293T cells transfected with HINT1 cDNA clone (Cat# RC203319) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203319 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDD
  ESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005331
• Locus ID: 3094
• UniProt ID: P49773, A0A384NPU2
• Cytogenetics: 5q23.3
• Refseq Size: 689
• Refseq ORF: 378
• Synonyms: HINT; NMAN; PKCI-1; PRKCNH1
• Summary: This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed. [provided by RefSeq, Dec 2015]