TGN46 (TGOLN2) (NM_006464) Human Mass Spec Standard

CAT#: PH303323

TGOLN2 MS Standard C13 and N15-labeled recombinant protein (NP_006455)

Product Images

Coomassie blue staining of purified TGOLN2 protein (Cat# TP303323). The protein was produced from HEK293T cells transfected with TGOLN2 cDNA clone (Cat# RC203323) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203323
• Predicted MW: 45.9 kDa
• Protein Sequence:
  Sequence Link

  >RC203323 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRFVVALVLLNVAAAGAVPLLATESVKQEDAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKS
  SAEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTKDSTSKSHPELQTPKDSTGKS
  GAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPNKSGADGQTPKDGSSKSGAEDQTPKDVPNKS
  GAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADT
  NQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSA
  SSENREGTLSDSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSK
  VTRRPKASDYQRLDQKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006455
• RefSeq Size: 6373
• RefSeq ORF: 1311
• Synonyms: TGN38; TGN46; TGN48; TGN51; TTGN2
• Locus ID: 10618
• UniProt ID: O43493
• Cytogenetics: 2p11.2
• Summary: This gene encodes a type I integral membrane protein that is localized to the trans-Golgi network, a major sorting station for secretory and membrane proteins. The encoded protein cycles between early endosomes and the trans-Golgi network, and may play a role in exocytic vesicle formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]
• Protein Families: Transmembrane