TGN46 (TGOLN2) (NM_006464) Human Recombinant Protein

CAT#: TP303323

Recombinant protein of human trans-golgi network protein 2 (TGOLN2)

Product Images

Coomassie blue staining of purified TGOLN2 protein (Cat# TP303323). The protein was produced from HEK293T cells transfected with TGOLN2 cDNA clone (Cat# RC203323) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203323 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRFVVALVLLNVAAAGAVPLLATESVKQEDAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKS
  SAEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTKDSTSKSHPELQTPKDSTGKS
  GAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPNKSGADGQTPKDGSSKSGAEDQTPKDVPNKS
  GAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADT
  NQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSA
  SSENREGTLSDSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSK
  VTRRPKASDYQRLDQKS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006455
• Locus ID: 10618
• UniProt ID: O43493
• Cytogenetics: 2p11.2
• Refseq Size: 6373
• Refseq ORF: 1311
• Synonyms: hTGN46; hTGN48; hTGN51; TGN38; TGN46; TGN48; TGN51; TTGN2
• Summary: This gene encodes a type I integral membrane protein that is localized to the trans-Golgi network, a major sorting station for secretory and membrane proteins. The encoded protein cycles between early endosomes and the trans-Golgi network, and may play a role in exocytic vesicle formation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2011]
• Protein Families: Transmembrane