Nucleophosmin (NPM1) (NM_002520) Human Mass Spec Standard
CAT#: PH303344
NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_002511)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203344 |
Predicted MW | 32.6 kDa |
Protein Sequence |
>RC203344 protein sequence
Red=Cloning site Green=Tags(s) MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGS PIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISG KRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQN GKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTD QEAIQDLWQWRKSL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_002511 |
RefSeq Size | 1449 |
RefSeq ORF | 882 |
Synonyms | B23; NPM |
Locus ID | 4869 |
UniProt ID | P06748, A0A0S2Z491 |
Cytogenetics | 5q35.1 |
Summary | 'The protein encoded by this gene is involved in several cellular processes, including centrosome duplication, protein chaperoning, and cell proliferation. The encoded phosphoprotein shuttles between the nucleolus, nucleus, and cytoplasm, chaperoning ribosomal proteins and core histones from the nucleus to the cytoplasm. This protein is also known to sequester the tumor suppressor ARF in the nucleolus, protecting it from degradation until it is needed. Mutations in this gene are associated with acute myeloid leukemia. Dozens of pseudogenes of this gene have been identified. [provided by RefSeq, Aug 2017]' |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404681 | NPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC419282 | NPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421985 | NPM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY404681 | Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 2 |
USD 396.00 |
|
LY419282 | Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1 |
USD 396.00 |
|
LY421985 | Transient overexpression lysate of nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 3 |
USD 396.00 |
|
PH303841 | NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_954654) |
USD 2,055.00 |
|
PH310458 | NPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001032827) |
USD 2,055.00 |
|
TP303344 | Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 1 |
USD 823.00 |
|
TP303841 | Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 2 |
USD 823.00 |
|
TP310458 | Recombinant protein of human nucleophosmin (nucleolar phosphoprotein B23, numatrin) (NPM1), transcript variant 3 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review