BIN3 (NM_018688) Human Mass Spec Standard

CAT#: PH303378

BIN3 MS Standard C13 and N15-labeled recombinant protein (NP_061158)

Product Images

Coomassie blue staining of purified BIN3 protein (Cat# TP303378). The protein was produced from HEK293T cells transfected with BIN3 cDNA clone (Cat# RC203378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203378
• Predicted MW: 29.7 kDa
• Protein Sequence:
  Sequence Link

  >RC203378 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNP
  LCEQDQDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPSLNMAVKRREQALQDYRRLQA
  KVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQLLEEMPRFYGSRLDYFQPSFESLIRAQVVYYS
  EMHKIFGDLSHQLDQPGHSDEQRERENEAKLSELRALSIVADD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_061158
• RefSeq Size: 1863
• RefSeq ORF: 759
• Synonyms: MGC14978
• Locus ID: 55909
• UniProt ID: Q9NQY0
• Cytogenetics: 8p21.3
• Summary: The product of this gene is a member of the BAR domain protein family. The encoded protein is comprised solely of a BAR domain which is predicted to form coiled-coil structures and proposed to mediate dimerization, sense and induce membrane curvature, and bind small GTPases. BAR domain proteins have been implicated in endocytosis, intracellular transport, and a diverse set of other processes. [provided by RefSeq, Jul 2008]