BIN3 (NM_018688) Human Recombinant Protein

CAT#: TP303378

Recombinant protein of human bridging integrator 3 (BIN3)

Product Images

Coomassie blue staining of purified BIN3 protein (Cat# TP303378). The protein was produced from HEK293T cells transfected with BIN3 cDNA clone (Cat# RC203378) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203378 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAVKISLDLLSNP
  LCEQDQDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPSLNMAVKRREQALQDYRRLQA
  KVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQLLEEMPRFYGSRLDYFQPSFESLIRAQVVYYS
  EMHKIFGDLSHQLDQPGHSDEQRERENEAKLSELRALSIVADD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 29.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061158
• Locus ID: 55909
• UniProt ID: Q9NQY0
• Cytogenetics: 8p21.3
• Refseq Size: 1863
• Refseq ORF: 759
• Summary: The product of this gene is a member of the BAR domain protein family. The encoded protein is comprised solely of a BAR domain which is predicted to form coiled-coil structures and proposed to mediate dimerization, sense and induce membrane curvature, and bind small GTPases. BAR domain proteins have been implicated in endocytosis, intracellular transport, and a diverse set of other processes. [provided by RefSeq, Jul 2008]