NAT13 (NAA50) (NM_025146) Human Mass Spec Standard

CAT#: PH303388

NAA50 MS Standard C13 and N15-labeled recombinant protein (NP_079422)

Product Images

Coomassie blue staining of purified NAA50 protein (Cat# TP303388). The protein was produced from HEK293T cells transfected with NAA50 cDNA clone (Cat# RC203388) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203388
• Predicted MW: 19.4 kDa
• Protein Sequence:
  Sequence Link

  >RC203388 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQK
  RLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYK
  RIEPADAHVLQKNLKVPSGQNADVQKTDN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_079422
• RefSeq Size: 6148
• RefSeq ORF: 507
• Synonyms: hNaa50p; MAK3; NAT5; NAT5P; NAT13; NAT13P; SAN
• Locus ID: 80218
• UniProt ID: Q9GZZ1
• Cytogenetics: 3q13.31