NAT13 (NAA50) (NM_025146) Human Recombinant Protein
CAT#: TP303388
Recombinant protein of human N-acetyltransferase 13 (GCN5-related) (NAT13)
View other "NAA50" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203388 protein sequence
Red=Cloning site Green=Tags(s) MKGSRIELGDVTPHNIKQLKRLNQVIFPVSYNDKFYKDVLEVGELAKLAYFNDIAVGAVCCRVDHSQNQK RLYIMTLGCLAPYRRLGIGTKMLNHVLNICEKDGTFDNIYLHVQISNESAIDFYRKFGFEIIETKKNYYK RIEPADAHVLQKNLKVPSGQNADVQKTDN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 19.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079422 |
Locus ID | 80218 |
UniProt ID | Q9GZZ1 |
Cytogenetics | 3q13.31 |
Refseq Size | 6148 |
Refseq ORF | 507 |
Synonyms | hNaa50p; MAK3; NAT5; NAT5P; NAT13; NAT13P; SAN |
Summary | N-alpha-acetyltransferase that acetylates the N-terminus of proteins that retain their initiating methionine (PubMed:19744929, PubMed:22311970, PubMed:21900231, PubMed:27484799). Has a broad substrate specificity: able to acetylate the initiator methionine of most peptides, except for those with a proline in second position (PubMed:27484799). Also displays N-epsilon-acetyltransferase activity by mediating acetylation of the side chain of specific lysines on proteins (PubMed:19744929). Autoacetylates in vivo (PubMed:19744929). The relevance of N-epsilon-acetyltransferase activity is however unclear: able to acetylate H4 in vitro, but this result has not been confirmed in vivo (PubMed:19744929). Component of a N-alpha-acetyltransferase complex containing NAA10 and NAA15, but NAA50 does not influence the acetyltransferase activity of NAA10: this multiprotein complex probably constitutes the major contributor for N-terminal acetylation at the ribosome exit tunnel, with NAA10 acetylating all amino termini that are devoid of methionine and NAA50 acetylating other peptides (PubMed:16507339, PubMed:27484799). Required for sister chromatid cohesion during mitosis by promoting binding of CDCA5/sororin to cohesin: may act by counteracting the function of NAA10 (PubMed:17502424, PubMed:27422821).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410864 | NAA50 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410864 | Transient overexpression lysate of N(alpha)-acetyltransferase 50, NatE catalytic subunit (NAA50) |
USD 396.00 |
|
PH303388 | NAA50 MS Standard C13 and N15-labeled recombinant protein (NP_079422) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review