NAT13 (NAA50) Rabbit Polyclonal Antibody

CAT#: TA346839

Rabbit Polyclonal Anti-NAT13 Antibody

Product Images

WB Suggested Anti-NAT13 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysate; NAA50 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NAT13 antibody: synthetic peptide directed towards the C terminal of human NAT13. Synthetic peptide located within the following region: AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: N(alpha)-acetyltransferase 50, NatE catalytic subunit
• Database Link:
  NP_079422
  Entrez Gene 80218 Human
  UniProt ID Q9GZZ1
• Background: NAT13 is a probable catalytic component of the ARD1A-NARG1 complex which displays alpha (N-terminal) acetyltransferase activity.
• Synonyms: hNAT5; hSAN; MAK3; NAT5; NAT5P; NAT13; NAT13P; SAN
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Guinea pig: 93%; Mouse: 86%