RDH14 (NM_020905) Human Mass Spec Standard

CAT#: PH303411

RDH14 MS Standard C13 and N15-labeled recombinant protein (NP_065956)

Product Images

Coomassie blue staining of purified RDH14 protein (Cat# TP303411). The protein was produced from HEK293T cells transfected with RDH14 cDNA clone (Cat# RC203411) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203411
• Predicted MW: 36.9 kDa
• Protein Sequence:
  Sequence Link

  >RC203411 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVATAAAVLAALGGALWLAARRFVGPRVQRLRRGGDPGLMHGKTVLITGANSGLGRATAAELLRLGARV
  IMGCRDRARAEEAAGQLRRELRQAAECGPEPGVSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLI
  NNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDLNSEQS
  YNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPV
  EGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGLLK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065956
• RefSeq Size: 1602
• RefSeq ORF: 1008
• Synonyms: PAN2; SDR7C4
• Locus ID: 57665
• UniProt ID: Q9HBH5, Q53RX3
• Cytogenetics: 2p24.2
• Summary: Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity toward 9-cis and all-trans-retinol. No steroid dehydrogenase activity detected. [UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane