RDH14 (NM_020905) Human Recombinant Protein

CAT#: TP303411

Recombinant protein of human retinol dehydrogenase 14 (all-trans/9-cis/11-cis) (RDH14)

Product Images

Coomassie blue staining of purified RDH14 protein (Cat# TP303411). The protein was produced from HEK293T cells transfected with RDH14 cDNA clone (Cat# RC203411) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203411 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVATAAAVLAALGGALWLAARRFVGPRVQRLRRGGDPGLMHGKTVLITGANSGLGRATAAELLRLGARV
  IMGCRDRARAEEAAGQLRRELRQAAECGPEPGVSGVGELIVRELDLASLRSVRAFCQEMLQEEPRLDVLI
  NNAGIFQCPYMKTEDGFEMQFGVNHLGHFLLTNLLLGLLKSSAPSRIVVVSSKLYKYGDINFDDLNSEQS
  YNKSFCYSRSKLANILFTRELARRLEGTNVTVNVLHPGIVRTNLGRHIHIPLLVKPLFNLVSWAFFKTPV
  EGAQTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGLLK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_065956
• Locus ID: 57665
• UniProt ID: Q9HBH5, Q53RX3
• Cytogenetics: 2p24.2
• Refseq Size: 1602
• Refseq ORF: 1008
• Synonyms: PAN2; SDR7C4
• Summary: Retinol dehydrogenase with a clear preference for NADP. Displays high activity towards 9-cis, 11-cis and all-trans-retinol. Shows a very weak activity towards 13-cis-retinol. Has no activity towards steroid.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome, Transmembrane