Apg3 (ATG3) (NM_022488) Human Mass Spec Standard

CAT#: PH303453

ATG3 MS Standard C13 and N15-labeled recombinant protein (NP_071933)

Product Images

Coomassie blue staining of purified ATG3 protein (Cat# TP303453). The protein was produced from HEK293T cells transfected with ATG3 cDNA clone (Cat# RC203453) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203453
• Predicted MW: 35.9 kDa
• Protein Sequence:
  Sequence Link

  >RC203453 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG
  KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS
  ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY
  QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG
  GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071933
• RefSeq Size: 1572
• RefSeq ORF: 942
• Synonyms: APG3; APG3-LIKE; APG3L; PC3-96
• Locus ID: 64422
• UniProt ID: Q9NT62
• Cytogenetics: 3q13.2
• Summary: This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
• Protein Pathways: Regulation of autophagy