Apg3 (ATG3) (NM_022488) Human Recombinant Protein
CAT#: TP303453
Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203453 protein sequence
Red=Cloning site Green=Tags(s) MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.7 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_071933 |
| Locus ID | 64422 |
| UniProt ID | Q9NT62 |
| Cytogenetics | 3q13.2 |
| Refseq Size | 1572 |
| Refseq ORF | 942 |
| Synonyms | APG3; APG3-LIKE; APG3L; PC3-96 |
| Summary | This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013] |
| Protein Pathways | Regulation of autophagy |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411559 | ATG3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY411559 | Transient overexpression lysate of ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) |
USD 436.00 |
|
| PH303453 | ATG3 MS Standard C13 and N15-labeled recombinant protein (NP_071933) |
USD 2,055.00 |
|
| TP720530 | Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China