Apg3 (ATG3) (NM_022488) Human Recombinant Protein

CAT#: TP303453

Recombinant protein of human ATG3 autophagy related 3 homolog (S. cerevisiae) (ATG3)

Product Images

Coomassie blue staining of purified ATG3 protein (Cat# TP303453). The protein was produced from HEK293T cells transfected with ATG3 cDNA clone (Cat# RC203453) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203453 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQNVINTVKGKALEVAEYLTPVLKESKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTG
  KQFLVTKNVPCYKRCKQMEYSDELEAIIEEDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCS
  ALCEEEEDEDEGEAADMEEYEESGLLETDEATLDTRKIVEACKAKTDAGGEDAILQTRTYDLYITYDKYY
  QTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTVTIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEG
  GGELGVHMYLLIFLKFVQAVIPTIEYDYTRHFTM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071933
• Locus ID: 64422
• UniProt ID: Q9NT62
• Cytogenetics: 3q13.2
• Refseq Size: 1572
• Refseq ORF: 942
• Synonyms: APG3; APG3-LIKE; APG3L; PC3-96
• Summary: This gene encodes a ubiquitin-like-conjugating enzyme and is a component of ubiquitination-like systems involved in autophagy, the process of degradation, turnover and recycling of cytoplasmic constituents in eukaryotic cells. This protein is known to play a role in regulation of autophagy during cell death. A pseudogene of this gene is located on chromosome 20. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
• Protein Pathways: Regulation of autophagy