NDUFA9 (NM_005002) Human Mass Spec Standard

CAT#: PH303464

NDUFA9 MS Standard C13 and N15-labeled recombinant protein (NP_004993)

Product Images

Coomassie blue staining of purified NDUFA9 protein (Cat# TP303464). The protein was produced from HEK293T cells transfected with NDUFA9 cDNA clone (Cat# RC203464) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203464
• Predicted MW: 42.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203464 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAAQSRVVRVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVV
  NHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFD
  FEDVFVKIPQAIAQLSKEAGVEKFIHVSHLNANIKSSSRYLRNKAVGEKVVRDAFPEAIIVKPSDIFGRE
  DRFLNSFASMHRFGPIPLGSLGWKTVKQPVYVVDVSKGIVNAVKDPDANGKSFAFVGPSRYLLFHLVKYI
  FAVAHRLFLPFPLPLFAYRWVARVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAI
  EVLRRHRTYRWLSAEIEDVKPAKTVNI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004993
• RefSeq Size: 1621
• RefSeq ORF: 1131
• Synonyms: CC6; CI-39k; CI39k; COQ11; MC1DN26; NDUFS2L; SDR22E1
• Locus ID: 4704
• UniProt ID: Q16795
• Cytogenetics: 12p13.32
• Summary: 'The encoded protein is a subunit of the hydrophobic protein fraction of the NADH:ubiquinone oxidoreductase (complex I), the first enzyme complex in the electron transport chain located in the inner mitochondrial membrane. A pseudogene has been identified on chromosome 12. [provided by RefSeq, May 2010]'
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease