FHL1 (NM_001449) Human Mass Spec Standard
CAT#: PH303478
FHL1 MS Standard C13 and N15-labeled recombinant protein (NP_001440)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203478 |
Predicted MW | 31.7 kDa |
Protein Sequence |
>RC203478 representing NM_001449
Red=Cloning site Green=Tags(s) MAEKFDCHYCRDPLQGKKYVQKDGHHCCLKCFDKFCANTCVECRKPIGADSKEVHYKNRFWHDTCFRCAK CLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGS FFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHADCFVCVTCSKKLAGQRFTAVEDQYYCV DCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHQEQVYCPDCAKKL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001440 |
RefSeq Size | 2398 |
RefSeq ORF | 840 |
Synonyms | FCMSU; FHL-1; FHL1A; FHL1B; FLH1A; KYOT; RBMX1A; RBMX1B; SLIM; SLIM-1; SLIM1; SLIMMER; XMPMA |
Locus ID | 2273 |
UniProt ID | Q13642 |
Cytogenetics | Xq26.3 |
Summary | 'This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. Expression of these family members occurs in a cell- and tissue-specific mode and these proteins are involved in many cellular processes. Mutations in this gene have been found in patients with Emery-Dreifuss muscular dystrophy. Multiple alternately spliced transcript variants which encode different protein isoforms have been described.[provided by RefSeq, Nov 2009]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400563 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431153 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431271 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431283 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431827 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431828 | FHL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400563 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 2 |
USD 396.00 |
|
LY431153 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 6 |
USD 396.00 |
|
LY431271 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 5 |
USD 396.00 |
|
LY431283 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 1 |
USD 396.00 |
|
LY431827 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 3 |
USD 396.00 |
|
LY431828 | Transient overexpression lysate of four and a half LIM domains 1 (FHL1), transcript variant 4 |
USD 396.00 |
|
TP303478 | Recombinant protein of human four and a half LIM domains 1 (FHL1) |
USD 823.00 |
|
TP328125 | Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 6. |
USD 748.00 |
|
TP328243 | Purified recombinant protein of Homo sapiens four and a half LIM domains 1 (FHL1), transcript variant 5. |
USD 748.00 |
|
TP328799 | Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 3. |
USD 748.00 |
|
TP328800 | Recombinant protein of human four and a half LIM domains 1 (FHL1), transcript variant 4. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review