ENTPD6 (NM_001247) Human Mass Spec Standard

CAT#: PH303487

ENTPD6 MS Standard C13 and N15-labeled recombinant protein (NP_001238)

Product Images

Coomassie blue staining of purified ENTPD6 protein (Cat# TP303487). The protein was produced from HEK293T cells transfected with ENTPD6 cDNA clone (Cat# RC203487) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203487
• Predicted MW: 53.1 kDa
• Protein Sequence:
  Sequence Link

  >RC203487 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKKGIRYETSRKTSYIFQPQHGPWQTRMRKISNHGSLRVAKVAYPLGLCVGVFIYVAYIKWHRATATQAF
  FSITRAAPGARWGQQAHSPLGTAADGHEVFYGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKALKPG
  LSAYADDVEKSAQGIRELLDVAKQDIPFDFWKATPLVLKATAGLRLLPGEKAQKLLQKVKEVFKASPFLV
  GDDCVSIMNGTDEGVSAWITINFLTGSLKTPGGSSVGMLDLGGGSTQIAFLPRVEGTLQASPPGYLTALR
  MFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAAS
  LHELCAARVSEVLQNRVHRTEEVKHVDFYAFSYYYDLAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLET
  QPQSSPFSCMDLTYVSLLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001238
• RefSeq Size: 2787
• RefSeq ORF: 2118
• Synonyms: CD39L2; dJ738P15.3; IL-6SAG; IL6ST2; NTPDase-6
• Locus ID: 955
• UniProt ID: O75354
• Cytogenetics: 20p11.21
• Summary: 'ENTPD6 is similar to E-type nucleotidases (NTPases). NTPases, such as CD39, mediate catabolism of extracellular nucleotides. ENTPD6 contains 4 apyrase-conserved regions which are characteristic of NTPases. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]'
• Protein Families: Secreted Protein, Transmembrane
• Protein Pathways: Purine metabolism, Pyrimidine metabolism