FAM3A (NM_021806) Human Mass Spec Standard

CAT#: PH303495

FAM3A MS Standard C13 and N15-labeled recombinant protein (NP_068578)

Product Images

Coomassie blue staining of purified FAM3A protein (Cat# TP303495). The protein was produced from HEK293T cells transfected with FAM3A cDNA clone (Cat# RC203495) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203495
• Predicted MW: 25.2 kDa
• Protein Sequence:
  Sequence Link

  >RC203495 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHL
  AFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPL
  HEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKY
  EGWPEALEMEGCIPRRSTAS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_068578
• RefSeq Size: 1821
• RefSeq ORF: 690
• Synonyms: 2.19; DLD; DXS560S; XAP-7
• Locus ID: 60343
• UniProt ID: P98173
• Cytogenetics: Xq28
• Summary: This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
• Protein Families: Secreted Protein, Transmembrane