FAM3A (NM_021806) Human Recombinant Protein

CAT#: TP303495

Recombinant protein of human family with sequence similarity 3, member A (FAM3A)

Product Images

Coomassie blue staining of purified FAM3A protein (Cat# TP303495). The protein was produced from HEK293T cells transfected with FAM3A cDNA clone (Cat# RC203495) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203495 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRLAGPLRIVVLVVSVGVTWIVVSILLGGPGSGFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHL
  AFRVVSGAANVIGPKICLEDKMLMSSVKDNVGRGLNIALVNGVSGELIEARAFDMWAGDVNDLLKFIRPL
  HEGTLVFVASYDDPATKMNEETRKLFSELGSRNAKELAFRDSWVFVGAKGVQNKSPFEQHVKNSKHSNKY
  EGWPEALEMEGCIPRRSTAS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068578
• Locus ID: 60343
• UniProt ID: P98173
• Cytogenetics: Xq28
• Refseq Size: 1821
• Refseq ORF: 690
• Synonyms: 2.19; DLD; DXS560S; XAP-7
• Summary: This gene encodes a cytokine-like protein. The expression of this gene may be regulated by peroxisome proliferator-activated receptor gamma, and the encoded protein may be involved in the regulation of glucose and lipid metabolism. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]
• Protein Families: Secreted Protein, Transmembrane