GMPR2 (NM_016576) Human Mass Spec Standard

CAT#: PH303584

GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660)

Product Images

Coomassie blue staining of purified GMPR2 protein (Cat# TP303584). The protein was produced from HEK293T cells transfected with GMPR2 cDNA clone (Cat# RC203584) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203584
• Predicted MW: 39.8 kDa
• Protein Sequence:
  Sequence Link

  >RC203584 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIA
  ANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQ
  VKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKT
  GVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKK
  YKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTT
  FIRVTQQVNPIFSEAC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057660
• RefSeq Size: 1910
• RefSeq ORF: 1098
• Synonyms: GMPR 2
• Locus ID: 51292
• UniProt ID: Q9P2T1
• Cytogenetics: 14q12
• Summary: This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017]
• Protein Families: Druggable Genome
• Protein Pathways: Purine metabolism