GMPR2 (NM_001002001) Human Recombinant Protein
CAT#: TP310599
Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 3
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210599 protein sequence
Red=Cloning site Green=Tags(s) MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKF SLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVE FVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAH GLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAG GVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002001 |
Locus ID | 51292 |
UniProt ID | Q9P2T1 |
Cytogenetics | 14q12 |
Refseq Size | 1930 |
Refseq ORF | 1044 |
Synonyms | GMPR 2 |
Summary | This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Purine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413898 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424314 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424315 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC424316 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425067 | GMPR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY413898 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 |
USD 325.00 |
|
LY424314 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 2 |
USD 325.00 |
|
LY424315 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 3 |
USD 325.00 |
|
LY424316 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 |
USD 325.00 |
|
LY425067 | Transient overexpression lysate of guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 |
USD 325.00 |
|
PH303418 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002000) |
USD 2,055.00 |
|
PH303584 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_057660) |
USD 2,055.00 |
|
PH310599 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002001) |
USD 2,055.00 |
|
PH323106 | GMPR2 MS Standard C13 and N15-labeled recombinant protein (NP_001002002) |
USD 2,055.00 |
|
TP303418 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 2 |
USD 823.00 |
|
TP303584 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 1 |
USD 823.00 |
|
TP323106 | Recombinant protein of human guanosine monophosphate reductase 2 (GMPR2), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review