Cofilin 1 (CFL1) (NM_005507) Human Mass Spec Standard
CAT#: PH303585
CFL1 MS Standard C13 and N15-labeled recombinant protein (NP_005498)
Other products for "CFL1"
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203585 |
Predicted MW | 18.5 kDa |
Protein Sequence |
>RC203585 protein sequence
Red=Cloning site Green=Tags(s) MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY EEVKDRCTLAEKLGGSAVISLEGKPL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005498 |
RefSeq Size | 1260 |
RefSeq ORF | 498 |
Synonyms | CFL; cofilin; HEL-S-15 |
Locus ID | 1072 |
UniProt ID | P23528, V9HWI5 |
Cytogenetics | 11q13.1 |
Summary | 'The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004]' |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.