Cofilin 1 (CFL1) (NM_005507) Human Recombinant Protein

CAT#: TP303585

Recombinant protein of human cofilin 1 (non-muscle) (CFL1)

Product Images

Coomassie blue staining of purified CFL1 protein (Cat# TP303585). The protein was produced from HEK293T cells transfected with CFL1 cDNA clone (Cat# RC203585) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203585 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYAT
  FVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCY
  EEVKDRCTLAEKLGGSAVISLEGKPL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005498
• Locus ID: 1072
• UniProt ID: P23528, V9HWI5
• Cytogenetics: 11q13.1
• Refseq Size: 1260
• Refseq ORF: 498
• Synonyms: CFL; cofilin; HEL-S-15
• Summary: The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004]
• Protein Families: Druggable Genome
• Protein Pathways: Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton