IFT43 (NM_052873) Human Mass Spec Standard

CAT#: PH303591

C14orf179 MS Standard C13 and N15-labeled recombinant protein (NP_443105)

Product Images

Coomassie blue staining of purified IFT43 protein (Cat# TP303591). The protein was produced from HEK293T cells transfected with IFT43 cDNA clone (Cat# RC203591) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203591
• Predicted MW: 23.9 kDa
• Protein Sequence:
  Sequence Link

  >RC203591 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKA
  SNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDL
  DNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQA
  RHT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443105
• RefSeq Size: 865
• RefSeq ORF: 639
• Synonyms: C14orf179; CED3; RP81; SRTD18
• Locus ID: 112752
• UniProt ID: Q96FT9, A0A024R6A9
• Cytogenetics: 14q24.3
• Summary: This gene encodes a subunit of the intraflagellar transport complex A (IFT-A). IFT-A is a multiprotein complex that plays an important role in cilia assembly and maintenance by mediating retrograde ciliary transport. Mutations in this gene are a cause of cranioectodermal dysplasia-3 (CED3), also known as Sensenbrenner syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]