IFT43 (NM_052873) Human Recombinant Protein

CAT#: TP303591

Recombinant protein of human chromosome 14 open reading frame 179 (C14orf179), transcript variant 1

Product Images

Coomassie blue staining of purified IFT43 protein (Cat# TP303591). The protein was produced from HEK293T cells transfected with IFT43 cDNA clone (Cat# RC203591) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203591 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKA
  SNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDL
  DNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQA
  RHT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_443105
• Locus ID: 112752
• UniProt ID: Q96FT9, A0A024R6A9
• Cytogenetics: 14q24.3
• Refseq Size: 865
• Refseq ORF: 639
• Synonyms: C14orf179; CED3; RP81; SRTD18
• Summary: This gene encodes a subunit of the intraflagellar transport complex A (IFT-A). IFT-A is a multiprotein complex that plays an important role in cilia assembly and maintenance by mediating retrograde ciliary transport. Mutations in this gene are a cause of cranioectodermal dysplasia-3 (CED3), also known as Sensenbrenner syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]