IFT43 (NM_052873) Human Recombinant Protein
CAT#: TP303591
Recombinant protein of human chromosome 14 open reading frame 179 (C14orf179), transcript variant 1
View other "IFT43" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203591 protein sequence
Red=Cloning site Green=Tags(s) MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGKNSSLTLTGETSSAKLPRCRQGGWAGDSVKA SNGTQTGKQQLDLNACYHKTHHRNLGLASLEEADIPIIPDLEEVQEEDFVLQVAAPPSIQIKRVMTYRDL DNDLMKYSAIQTLDGEIDLKLLTKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQTEKEDPAGQA RHT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443105 |
Locus ID | 112752 |
UniProt ID | Q96FT9, A0A024R6A9 |
Cytogenetics | 14q24.3 |
Refseq Size | 865 |
Refseq ORF | 639 |
Synonyms | C14orf179; CED3; RP81; SRTD18 |
Summary | This gene encodes a subunit of the intraflagellar transport complex A (IFT-A). IFT-A is a multiprotein complex that plays an important role in cilia assembly and maintenance by mediating retrograde ciliary transport. Mutations in this gene are a cause of cranioectodermal dysplasia-3 (CED3), also known as Sensenbrenner syndrome. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409416 | IFT43 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420159 | IFT43 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC426182 | IFT43 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409416 | Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 1 |
USD 396.00 |
|
LY420159 | Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 2 |
USD 396.00 |
|
LY426182 | Transient overexpression lysate of chromosome 14 open reading frame 179 (C14orf179), transcript variant 2 |
USD 396.00 |
|
PH303591 | C14orf179 MS Standard C13 and N15-labeled recombinant protein (NP_443105) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review