MOSC1 (MARC1) (NM_022746) Human Mass Spec Standard

CAT#: PH303674

MOSC1 MS Standard C13 and N15-labeled recombinant protein (NP_073583)

Product Images

Coomassie blue staining of purified MARC1 protein (Cat# TP303674). The protein was produced from HEK293T cells transfected with MARC1 cDNA clone (Cat# RC203674) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203674
• Predicted MW: 37.5 kDa
• Protein Sequence:
  Sequence Link

  >RC203674 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGAAGSSALARFVLLAQSRPGWLGVAALGLTAVALGAVAWRRAWPTRRRRLLQQVGTVAQLWIYPVKSCK
  GVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCDGDTLTLSAAYTKDLLLPIKT
  PTTNAVHKCRVHGLEIEGRDCGEAAAQWITSFLKSQPYRLVHFEPHKRPRRPHQIADLFRPKDQIAYSDT
  SPFLILSEASLADLNSRLEKKVKATNFRPNIVISGCDVYAEDSWDELLIGDVELKRVMACSRCILTTVDP
  DTGVMSRKEPLETLKSYRQCDPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_073583
• RefSeq Size: 2258
• RefSeq ORF: 1011
• Synonyms: MOSC1
• Locus ID: 64757
• UniProt ID: Q5VT66
• Cytogenetics: 1q41
• Protein Families: Transmembrane