TrkC (NTRK3) (NM_001007156) Human Mass Spec Standard
CAT#: PH303781
NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_001007157)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC203781 |
| Predicted MW | 68.5 kDa |
| Protein Sequence |
>RC203781 protein sequence
Red=Cloning site Green=Tags(s) MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNAS INITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQPRAFAKNPHLRYINLSSNRLT TLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEAKLNSQNLYCINADGSQLPLFRMNISQCDLP EISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGF TLTCIAENVVGMSNASVALTVYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHV EYYQEGEISEGCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASPLHHINHGITT PSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTWVFSNIDNHGILNLKDNRDHLVPSTHYIYEEP EVQSGEVSYPRSHGFREIMLNPISLPGHSKPLNHGIYVEDVNVYFSKGRHGF myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001007157 |
| RefSeq Size | 4141 |
| RefSeq ORF | 1836 |
| Synonyms | gp145(trkC); GP145-TrkC; TRKC |
| Locus ID | 4916 |
| UniProt ID | Q96CY4 |
| Cytogenetics | 15q25.3 |
| Summary | 'This gene encodes a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2011]' |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
| Protein Pathways | Neurotrophin signaling pathway |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400902 | NTRK3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LY400902 | Transient overexpression lysate of neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2 |
USD 665.00 |
|
| PH313333 | NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_002521) |
USD 2,055.00 |
|
| PH319113 | NTRK3 MS Standard C13 and N15-labeled recombinant protein (NP_001012338) |
USD 2,055.00 |
|
| TP303781 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 3 |
USD 867.00 |
|
| TP313333 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 2 |
USD 823.00 |
|
| TP319113 | Recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1 |
USD 748.00 |
|
| TP700136 | Purified recombinant protein of human neurotrophic tyrosine kinase, receptor, type 3 (NTRK3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 748.00 |
|
| TP710140 | Recombinant protein of human mitotic spindle organizing protein 2A (MZT2A), residues 32-429aa, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 425.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China