C5R1 (C5AR1) (NM_001736) Human Mass Spec Standard

CAT#: PH303784

C5AR1 MS Standard C13 and N15-labeled recombinant protein (NP_001727)

Product Images

Coomassie blue staining of purified C5AR1 protein (Cat# TP303784). The protein was produced from HEK293T cells transfected with C5AR1 cDNA clone (Cat# RC203784) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203784
• Predicted MW: 39.3 kDa
• Protein Sequence:
  Sequence Link

  >RC203784 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI
  NAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFK
  PIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLG
  FLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNK
  LDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001727
• RefSeq Size: 2342
• RefSeq ORF: 1050
• Synonyms: C5A; C5AR; C5R1; CD88
• Locus ID: 728
• UniProt ID: P21730
• Cytogenetics: 19q13.32
• Summary: ''
• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Complement and coagulation cascades, Neuroactive ligand-receptor interaction