C5R1 (C5AR1) (NM_001736) Human Recombinant Protein
CAT#: TP303784
Recombinant protein of human complement component 5a receptor 1 (C5AR1)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203784 protein sequence
Red=Cloning site Green=Tags(s) MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTI NAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATISADRFLLVFK PIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEYFPPKVLCGVDYSHDKRRERAVAIVRLVLG FLWPLLTLTICYTFILLRTWSRRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLNK LDSLCVSFAYINCCINPIIYVVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.1 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | Binding assay (PMID: 29981048) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001727 |
| Locus ID | 728 |
| UniProt ID | P21730 |
| Cytogenetics | 19q13.32 |
| Refseq Size | 2342 |
| Refseq ORF | 1050 |
| Synonyms | C5A; C5AR; C5R1; CD88 |
| Summary | Receptor for the chemotactic and inflammatory peptide anaphylatoxin C5a (PubMed:1847994, PubMed:8182049, PubMed:7622471, PubMed:9553099, PubMed:10636859, PubMed:15153520, PubMed:29300009). The ligand interacts with at least two sites on the receptor: a high-affinity site on the extracellular N-terminus, and a second site in the transmembrane region which activates downstream signaling events (PubMed:8182049, PubMed:7622471, PubMed:9553099). Receptor activation stimulates chemotaxis, granule enzyme release, intracellular calcium release and superoxide anion production (PubMed:10636859, PubMed:15153520).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, GPCR, Transmembrane |
| Protein Pathways | Complement and coagulation cascades, Neuroactive ligand-receptor interaction |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400657 | C5AR1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400657 | Transient overexpression lysate of complement component 5a receptor 1 (C5AR1) |
USD 436.00 |
|
| PH303784 | C5AR1 MS Standard C13 and N15-labeled recombinant protein (NP_001727) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China