NHLH1 (NM_005598) Human Mass Spec Standard

CAT#: PH303893

NHLH1 MS Standard C13 and N15-labeled recombinant protein (NP_005589)

Product Images

Coomassie blue staining of purified NHLH1 protein (Cat# TP303893). The protein was produced from HEK293T cells transfected with NHLH1 cDNA clone (Cat# RC203893) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC203893
• Predicted MW: 14.6 kDa
• Protein Sequence:
  Sequence Link

  >RC203893 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRR
  RATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005589
• RefSeq Size: 2594
• RefSeq ORF: 399
• Synonyms: bHLHa35; HEN1; NSCL; NSCL1
• Locus ID: 4807
• UniProt ID: Q02575, Q5T203
• Cytogenetics: 1q23.2
• Summary: 'The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM, Nov 2002]'
• Protein Families: Transcription Factors