NHLH1 (NM_005598) Human Recombinant Protein

CAT#: TP303893

Recombinant protein of human nescient helix loop helix 1 (NHLH1)

Product Images

Coomassie blue staining of purified NHLH1 protein (Cat# TP303893). The protein was produced from HEK293T cells transfected with NHLH1 cDNA clone (Cat# RC203893) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203893 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRR
  RATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_005589
• Locus ID: 4807
• UniProt ID: Q02575, Q5T203
• Cytogenetics: 1q23.2
• Refseq Size: 2594
• Refseq ORF: 399
• Synonyms: bHLHa35; HEN1; NSCL; NSCL1
• Summary: The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM, Nov 2002]
• Protein Families: Transcription Factors